Want to comment during the show for Richie? Drop your comment right in here. Please note all comments will be removed from this post within 24-48 hours.
Live Comment
- AdminRA
- August 14, 2021
- 1:11 am
- 2774 Comments
2.8K Comments
Evenin’ all; whatever happened to Field McConnel…?
Chuck Burlingame II, was the so called pilot of the Hijack by Hani Hanjour, and yet, he was part of the Summer Pentagon Wargame on a scenario of a Plane into the Pentagon!
Chuck, was ex vietnam veteran and unlikely overpowered by some scrawny terrorists.
Oddly Barbara Olson, was on Flight 77 too, and called Ted Olson her husband, working in the Pentagon, from a seat back phone, in reverse charges, which was later retracted, as it was proved that that model of Boeing, had no seat back phones!
Ted, despite his wifes death JUST NOW, went and gave a press speech from the Pentagon Lawn, about her phone call describing “Terrorists on the plane wearing headbands and with bomb belts!” All very very suspicious!
There were parts of shredded United Airlines plane fuselage all over the lawn, pictured being picked up, plus landing gear, wheels and engine parts inside the pentagon. Burnt chairs and more. Oddly the serial numbers of engine parts were wrong, and the Flight Recorder NIST data flight path, does not match the claimed flight path. Despite endless highway witnesses and seized cameras, we still are in the dark of the truth of what happened.
Same with 7/7. The more you look the weirder it gets. All on purpose.
GLOBAL HAWK tech MUST have been used to override the PILOTS and precision slam into every target.
GodBlessHim,NoGoodDeedGoesUnpunished
RE: 9/11: A dental receptionist actually fell down a flight of stairs in haste and panic, to inform the sedation clinic doing maxillofacial surgery I was in, that “A PLANE has hit the Twin Towers!”. I later on a break, got to call my ex-wife, and she speaking on the phone, whilst PLANE 2 slammed live into the 2nd Tower! That is my FLASHBULB MEMORY of 9/11.
I was too busy to even look into it all unto 2005, and saw WTC7 fall for the 1st time. I called my wife downstairs to rewatch the clip and we both said…. “OMG that’s a Controlled Demolition, neatest ever seen and how the hell have we never heard of this before on 9/11” So began our wake up call for real.
I’m of a mind to believe the “no plane” theory…
How is it possible for a aluminium bodied object to penetrate a steel and concrete building ?
Minoru Yamasaki designed the Towers to take multiple, smaller, faster, higher kinetic energy plane impacts at full speed and full fuel loads.
Aluminium would have shredded to pieces at those speeds but the heavier engines and landing gear would have gone into the building and as we saw, through it! They landed in the street. Or in the inner rings of the Pentagon, despite the one section of hardened concrete that had been installed on that particular area a few years earlier. Which was a penetration test perhaps of such reinforcement work. Along with possible bombs. Pictures of plane parts at all sights are there. Less so with Flight 93’s crater, as its claimed its debris field was over a massive area, from an explosion before it crashed.
I was in LA with th Rodney King thing. The TV continually showed him beaten up then after that they showed a white lorry driver being pulled out of a truck and beaten to death. Scum of the earth the media.
Evening folks, late to the party, just back from the gun club.
I disagree that we are closer to global conflict than ever, certainly not nuclear. I think the complete opposite may be true. Because the hidden hand has almost total control over nation states, more so than any other time in history. Therefor very unlikely to happen unless wanted.
I dont believe a devastated planet is wanted, rather they want it as their own playground. I believe Orwell, who spoke of perpetual controlled conflict being necessary, in order to keep the masses in check.
Last edited 3 months ago by Urban Fox
My bro and wife used to do Dry January but throughout such, they were stockpiling booze and planning huge parties as soon as February hit! They would always hit the stuff harder on each return! It was predictable as drinks slippery slope! However they are now very healthy again and running marathons and such, despite undisclosed batches of covid shots, which MUST have been Saline ones, or they’d be dead.
Evening Richie, great THE PAPERS show today! 🙂 Evening one and all 🙂
Hi Pan, I laughed my socks off, at Richie’s imagined responses to some people being asked to have jabs. The funniest being the school girl telling her teacher. ” Why don’t you just f**k off.” He he he, ha ha ha ha haaaaaaaaaaaaaa.!
Evening Fox, yes Richie is very funny in his wordplay and mockery and his epic rants! Always amusing 🙂
From the other night.
Dog wagging tail.
Since one of the main senses of a dog is the nose, and at the other end it has a sent gland, this wagging of tail wafts it’s sent as a way of greeting to other dogs and people it knows.
It’s a dog handshake.
In my opinion.
Or it might of been in ‘The Papers’.
yeah the tail wagging thing, was IN “The Papers” the other day and as Ben Elton once famously did a routine of, on Saturday Night “live” back in the Eighties, he explained why all newspapers were full of shit, where they belong.
It was squirrels and where they squirrel away their nuts….. obviously not where they choose to store their food away!
So Squirrels, choose different trees for food and nests and crapping in!
Well the Logging companies come around and put an X here or there an X everywhere to a Squirrel an X X X and so they chose the trees with the X on, to shit in, as their place to.
Those trees X marked, get cut down later by loggers, if an Alien Encounter from a different kind does not happen to the whole crew and only someones Fire of the Caught you Rye, then…and only then…. when Travis had been returned did the logging company take down all the XXX marked trees and so it went!
Which meant, that the remaining trees, got chopped down, whilst bright eyed, bush tailed ones hid and those trees with X’s on, got made into newspapers!
Yeah the ones full of shit!
Nothing has changed since Ben Elton pointed that out in the 80’s when I was a child.
its obvious that cancers are on the rise nobody was diagnosed during convid and the poison jabs only added to the amount of cases, big harma dont want cures only customers
Royal Rife Colin?
The lack of diagnosis during conFLID was disproven in various papers. Serious screening did indeed continue to take place, in the EMPTY DonnorCNT HERO EATING, Tik Tok Dancing nursing wards.
Whitty tried later to blame it on lack of statins. Which was even shot down by jab hocking Lack of Evidenced Professor CUNT Malhotra as Abi Roberts would say deservedly. Especially when he hocked it to BAME and then admitted later….oh…shit…my dads dead…I never even check the jabs out! OR ANY PRIOR JABS…that he had hocked for decades!
Big harma — I like it Colin 👌
Always good to hear from Paul. Pyke’s letter to Manzini predicted the destruction of Israel and the Muslim world. Sounds like he may have been right!
Did you know that, Sebastian Fox, Corinne Stockheath, and Michael Green are all Grant Shapps ?
Hmmm not quite sure what you mean here Joe Public.
are you suggesting they are one ACTOR? or Something else?
These were all names used by our minister of war before he went into politics.
What a great man PCR is. Fascinating listening to him. Great work Richie .
Every time I hear Paul, he reminds me of Blain in the first Predator film.
You haven’t got time to grow tobacco to be a sexual tryannosaur, as you are dug in, like a gardeners assistant tit!
You haven’t got time to grow tobacco to be a sexual tryannosaur, as you are dug in, like a gardeners assistant tit!
Hi Pan, I accidentally grew a tobacco plant at one of my customers last year.
We don’t know how, but one appeared in his garden and we went with it. I was going to dry the leaves and have a go, but it got destroyed when we had the first frost.
Russia dragging its heels supporting Iran is only the latest example of why I don’t trust Putin as an opposition to the NATO cabal…
USA & UK want IRAN to ReAct… They want to Drag Iran into it so, Nothing will stop them. Even if they make such announcement, There could a Psy-Op a Flas-Flag to counter it
Vaccines have likely been the primary cause of illnesses for over a century
By Rhoda Wilson
It doesn’t matter that Penny Mordant is “only carrying out orders”; carrying out criminal orders is itself a crime, and you have to start prosecuting the front person to get any chance of exposing the conspiracy…
I sent you yesterday the WAKEFIELD Court case evidence documentary Richie! He was vindicated but via co-authors as not able to appeal such himself!
https://childrenshealthdefense.eu/chd-europe-tv-english/
He also never stated MMR = Autism, merely “precautionary principles, as something seemed to be going as possible causal relationship of MMR jabs, and all the issues noted!” – paraphrase of course.
Wakefield did NOTHING WRONG EVER and came back with a Vengeance to prove far more than he ever knew he had ever stumbled upon by accident!
Dr Richard Halvorsen, was a prior TV Doctor, as was Dr Vernon Coleman.
Coleman, stood strong over a far simpler issue, of medical privacy as “Patient Doctor Relationship” over SICK NOTES!
NOW… we have PCR TESTS and LFT and Rapid Antigen and PINGDEMICS of Bluetooth enabled DUMBFUCKS on “Smartphones” all taking FAKE PCR and other tests, and then allowing, or believing a PING means a +VE COVID TEST and that they have to stay home for 14 days…. playing X-BOX and selling arse on ONLY FANS!
Now…. Halvorsen called out the Aluminium in jabs! He lost his TV Doctor Career.
He again….stumbled onto a TRUTH!
He got tired of ANTI-VAXXER MUMS in his medical practice and decided to DEBUNK ANTI-VAXXERS and he FAILED….
Instead…. he said…WTAF? And spent 7 years to write his book pre HPV “the vaccine too soon chapter!” …predicting the HARMS that HPV jabs would cause, over the 11th lowest cancer in women, that also had NO PROOF that HPV exists, or causes Cervical Cancer. WHICH IT DOES NOT!
Halvorsen over MMR, decided like Wakefield to go back to SINGLE JABS….AFTER…IMMUNITY BLOOD TESTING?
Recall that DAISY PRICK TEST at school? Seeing if you had a reaction? If no reaction….they gave you the SHOTS of BCG for TB and a gamut of Jabs etc.
Because they sold the idea of return to single vaccines and not M M R, all of which are POINTLESS…as no such diseases even EXIST….. by even return to single shot selling to cautious parents…. they had their careers DESTROYED!!!
Defective is not the best word to describe kids wih autism
They end up UNIQUE and with view a different perspective of life. Some of them sadly, so terribly brain damaged or in other ways that they cannot function at all and neither can their parents. Others are GIFTED in new ways. Some excel.
Please see TEMPLE GRANDIN the movie with Clare Danes and the real lady!
Yes. Thanks for the tip.
Evenin’ all, I tried googling the Andrew Wakefield case and of course all the results are it pieces; its impossible to find anything from Clifford or Wakefield refuting this stuff…
Brexit’s currently costing me approximately $170 per month.
What an eloquent lady on Sky News.
The Yemeni parliament in Saana has proscribed both US and UK as terrorist states and enterprises.
Theresa May…. ahh yes I recall her!
‘The worst part about being lied to is knowing you weren’t worth the truth.’ Jean-Paul Sartre.
Theresa : A Cautionary Tale
(with apologies to Hilaire Belloc)
by PKM
Theresa told such Shocking Lies
It made one Gawp in Stunned Surprise,
A Troubling Trait and somewhat Odd,
Her Father being a man of God,
A Firm Believer in Veracity
Whose Only Child espoused Mendacity.
Having made Money in the City,
Theresa soon was Sitting Pretty
And set sail on her Next Career
To achieve an Aim she’d long held Dear,
For telling Lies she knew would be
An Asset in a new MP.
She Networked daily hour by hour
Until she Rose to Giddy Power
In charge of UK Home Affairs.
(She’d made it up the slippery stairs!)
Now she would Make them all Obey.
They’d find Hers was the Only Way.
With HMRC she made her mark
And singled out one Brodie Clarke.
That Man must Learn to Follow Orders
And Gain Control of UK borders.
Illegal Migrants coming over
And flooding through the port of Dover
Was Not Theresa’s Plan at all.
She’d Pledged to Make the Numbers Fall,
But chopped Five Thousand Staff instead
And then, alas, poor Brodie’s Head.
He lost his Job, his Reputation,
But thanks to Damage Limitation—
A secret settlement some guess—
Theresa Shed Blame for the Mess
And moved against our Boys in Blue
To tell them Bluntly they Must Do
Far More for Less! Commands they heard
And met with Silence. Not a Word!
She sent home Students by the Score
Although it was against the Law.
She claimed they’d Failed their English Test,
Which wasn’t True, but she Knew Best.
Hah! away with Human Rights Acts!
Fiction’s far more Fun than Dull Facts!
‘We all know tales of HRA,
Why Migrants can’t be sent away.
Because the poor Man has a Cat!
It’s true! What do you think of that?’
‘Rubbish! Just a made-up Story!’
Cried Old Ken Clarke, the Justice Tory.
Her Promise to make Numbers Fall
Remained an Order far too Tall
For still they came, just as before,
From Far and Near and every Shore.
The Numbers Never did come Down
Of white and yellow, black and brown.
Now six years on the country’s Lock-ups,
Because of Saint Theresa’s Cock-ups,
Are Over-crowded, full of Drugs,
And run by Rioters and Thugs
In Crumbling Buildings, short of staff,
But for Theresa it’s a Laugh.
She’s moved on Upwards on a roll.
She’s PM now in full Control.
‘What joy, what bliss!’ the Tories Bray,
‘Now Nanny’s running the UK.
We’ll send those Bloody Foreigners packing.
We’ll kick the Poor and stop them Slacking.
Brexit’s the next stage in our story.
Back with the clocks to Days of Glory
When Britain was Great and Life was Hell,
And Workers knew their place as well.
An island race we’re Proud to be,
Alone we’ll stand, Proud to be Free.’
Free to be weaker, poorer, spend less; Free to be hungry, homeless, friendless;
Free to be ill unless we Pay; No NHS, just USA?
‘Pah! hoist the Flag; we Rule the Waves.
We Brits, we Never shall be Slaves!’
Theresa’s pledged—her Will be Done!—
The Country’ll work for Everyone
When she has used her female charms
Selling murdering Despots Arms.
Pride comes before a Fall they say
And soon will come the Reckoning Day
For Proud Theresa. She will Learn
That boats can Capsize, Sink or Burn.
Does anyone know how there are any of these Yemeni Houthi’s left? I’m pretty sure that Saudi Arabia and the UK have been blasting them with giant weapons for 10 years now. Whatever they’re doing they must be pretty good at it.
Richie,forthoseofuswhowanttoavoidEMRradiationandsurveillanceitssadthattheforumisbeingsupplantedbytheapp.
SPOTTEDDICKSJACKSSMARTAPPSFLAPPEDASMACKSFROMATOWERSGEOLOCATESSMACKEDASSEDDIPPYSHITSISNEVRTOOSHITZYBLIZTEDTORECOGNIZETHESYSTEMSWONDERWHIPSOFCHIPSTOBECHAINSSOONUPONYOURREPLACEDAPPLEDWATCHEDWRISTSANDBACKTOFULLSLAVECOLLARSASTHEIRSLAVESAMIDSTTHESOCALLEDELITESANDITSALLASCAMJUSTASBEFOREYET5GWILLGIVETHENETFLIXFORPORNHUBFASTERANYDAYSOHEYHOHAILHOESANDOFTHEFREEDOMTOTHEBLUESMURFSGOANDGARGLEWELLSCATSWALLOWSNOTSPATANDITSWHATALLOURPOLITICIANSANDBANKERSTHINKOFTHATASVIEWEDASSPEWEDDOWNTHROATEDTHROATSWEAREASIFWEWEREBELUGACAVIARANDANOYSTERFROMAWALRUSFROOACARPENTERTHEYREFSUETOPAYTOHOUSEUSORALLOWTHENAILSONTHEIROWNCROSSESBACKSTOCARRYASTHEYALLCARRYONHAPPYASLARRYANDNOWALLOWANCEFORTHEREALASTHEYASTHIEVESANDFAKESAVIOURSINTHEMIDDLESHALLBERIDDLEDBESTSTILLANDSENTINTOTHATLONGKNOWNOFEXILEDEMONDFILLED
If the lesbians place an ad for a donner ,blokes will be queuing around the block.
The WHO can talk about this all they like. I will under no circumstances go along with their rules. I was not in the room when they agreed what ever they agree. You want to know who can stop this nonsense, just look in the mirror!!
They are talking about things worse than covid, yet covid managed not to cause annual excess deaths . Though it was supposedly much worse than regular flue. After the scam of the last 4 years worked so well, there is absolutely no need to knock out something genuine. Surely the only weapons needed are the JABS, which have been proven to cause harm and kill.
Spot on. Tedbros said Covid was the prior Disease X and came along. NO NOTHING DID. So now he says “X is name for unknowns we expect soon, but X IS KNOWN” Which means he is suggesting they already know what new Disease X.
As you say Covid did nothing. It was a fear campaign and nothing real. No excess deaths anywhere, all other death iatrogenic and medical murders and malpractices. No pandemic. Now we have a REAL JabOdemic and death through the roof in all ways possible and ZIP ZILCH spoken of such. Its all a scam.
Thanks well said. Jabodemic yes. They will simply pass off various symptoms as a new disease, as they have before. Only this time it will be due to the Jab injuries and deaths still to come.
Last edited 3 months ago by Urban Fox
Thats better… =)
I’m confused.
I thought we were meant to “eat ze bugs”, now I’m being told we have to find them first?
Different bugs?
I’ll get me coat…….
Last edited 3 months ago by Chris-the-Gardener
Ahahahha so well put mate 🙂
It wasn’t my best work, but if it made one person smile, it was worth doing.
Podcasting with Chris again tonight Pan, if you’re about later, come and say hello.
I found it funny yes mate. I will pop along for sure, whilst amidst other shows 🙂
Pathogens with pandemic potential is all nonsense sorry. They are fearmongering and want to share in-sillico modelled, made up sequences, from genebanks, which are all unproven in reality and merely constructs, of a soup of cell cultures. So its a lie basically.
This is nonsense as you say. They are talking about things worse than covid, yet covid managed not to cause any excess deaths. Yet we are told how much worse it was than regular flue. After the scam of the last 4 years worked so well, there is absolutely no need to knock out something genuine. Surely the weapons’ are the JABS, which have been proven to cause harm and kill.
‘They’ are the virus.
Oh yes! We need a real vaccine, or at least lots of needles in voodoo dolls of them for now, as we have not exhausted that option of maybe working for now. Afterall they have Shamans blowing spirits into their heads at the WEF. So W.H.O knows, perhaps such will work before we have to shove every vile vial of their toxic crap into themselves for real 😉
Hi Baird, yes indeed.
Computer modelling is the king bullshit of all bulls in this.
I am not convinced that ‘they’ can’t engineer pathogens though. It may be that it’s not worked to engineer so-called viruses that transmit, however can they get something into the masses? – I’d say yes – and if I’m combination with environmental factors that they do control I do think they can engineer a pandemic.
I believe this agreement is the next step in going live with open totalitarian world goverment. The opening salvo which happened in 2020, where around the globe the world was put under medical tyranny. The WHO being a department of the world goverment, though they are administrating orders of the unseen. It seems the plan is to use ‘medical science’, as the driving force behind the whole agenda. Even climate change is being tied in with our health.
Last edited 3 months ago by Urban Fox
Good point, well made Fox.
Thanks Chris, what’s new with you.?
All good mate, beautiful day today in Narfolk.
I’ve got a big number 12 on my back this evening, I’ve been called off the bench by Mr Von Essex for tonight’s show, so Hopefully see you there.
When do we get to see you again? Chris said you’re doing a pre-record sometime soon??
I was originally booked for tonight, but put it off till next Monday. ”Law of attraction special”. I’ve not been well so i still have a lot of prep to do. The pre-record has been done. We did it in one take the other week. I’m just waiting for Chris to edit it, and add the video clips I’ve sent him. I will do my best tonight, take care. Fox
The WHO can talk about this all they like. I will under no circumstances go along with their rules. I was not in the room when they agreed what ever they agree. You want to know who can stop this nonsense, just look in the mirror!
Spot on Diane, that gets a “like” from me.
I can’t get to Jayne’s website.
http://www.jayne-dunigan.co.uk/ ?
Seems dead yes
Hmm…
No results on Google or even twitter; Do we have the spelling right…?
Could it be being blocked?
I have been listening since 2014 and with my hand on my heart Jayne is the best guest ever! From William with a W 🙂
” We are reaching a turning point in our history, the proof is everywhere. The world is becoming a more dangerous place.” Grant Shapps MP
Recent online advert. Where throughout Shapps gleefully talks of things such as viruses and preparing for war with Russia. Fear propaganda at its finest.
https://twitter.com/grantshapps/status/1746914238935818583
Hi_Richie_they-name-storms-after-both-boy-and-gril-names-every-secon-one
Hi Richie
I firmly believe that the childhood jabs caused my daughter’s childhood Leukaemia.
So many kids developing childhood cancers age 3-5.
When I was young in the 60s kids were much healthier than they are now.
Autism and cancer in kids were extremely rare pre the mass jab roll outs.
Given Polio is unproven as a virus, instead DDT more likely, we know that Gates polio jabs spread fecal oral to other kids in India and elsewhere and cause Acute Flaccid Paralysis (same as “Polio” symptoms). So what is really in the Polio shots? Is it DDT which then poisons others too?
Yup, nobody heard of flacid myelitis before polio jabs and now, when polio is supposed to be gone, we have this instead…
Bingo, Doctors were told that Polio shots had eradicated Polio and they changed the way the same symptoms were labelled, to make it look so, as they slowly withdrew DDT and Lead Arsinates.
Same things with SIDS in babies from vaccines. They relabelled such as Suffocation, or Shaken baby syndrome, or anything but Sudden Infant Death Syndrome and it carried on regardless, whilst they ramped up DTP and Dtap shots and carried on murdering babies and blaming mums for COT DEATH and how they put the baby down at night and blah blah blah. Anything to cover the jab to SIDS link.
Now we have SADS, priorly rare but classified I think in 2012, but now any excuse to excuse the covid shots from SADS. Shaking your duvet too hard, shovelling snow, too much or too little heating, too much exercise or sex, climate change… anything but say “YUP the JABS ARE KILLER!”.
22 years ago I delivered my first baby. In hospital they told me my blood showed I was not immune to German measles. I was instructed to get jabbed for it before leaving the hospital. I took the jab because I trusted them. I was young and dumb and regret it, but not as much as I regret vaccinating my children all their lives until 2017 when I started digging.
Greetings, theres going to trouble if they really phase out smoking and replace it with “heated tobacco”; I tried it myself in the hope I could switch my mum over to it as she couldn’t stand vapes, but it tastes terrible, a bit like lighting a ciggy at the filter end…
This new time is still catching me out! The penny will drop with me soon!
How can you have a LIVE VIRUS, when they have always said Viruses are DEAD and require living host cells to replicate within, using the host cells machinery, and their Virus code to copy? So attenuation supposedly weakens, something DEAD? Do the jabs contain LIVE HUMAN CELLS that the viruses are busy replicating within? If so, then the Ingredients lists will be WRONG, as they claim a specific number of viral particles in each shots vial? LOGICALLY it’s therefore all BS.
They cant even show you a viral particle, yet they can weld nanobot materials together 1000x smaller than claimed viral particles, and SHOW YOU pictures of such! Makes no sense.
Yeah it’s rubbish isn’t it. They just add something utterly toxic like formaldehyde to the contents to ‘attenuate’. Or they’ll supposedly delete certain proteins from the ‘virus’. It’s easier with bacterial vaccines to ‘weaken’ them, but in general I think it’s best to accept that almost all vaccines are totally unnecessary and designed to make us all sick.
Yeah it all seems made up. How can you delete a protein, on the cell surface of something in the millions, that you cannot even prove you can see at all? Makes no sense.
bacterial vaccines, like HIB or TB etc I accept are genuine bacteria we can see and yes we can weaken them and not kill them prior to injection. However foundational science on TB bacteria in Cows, proved nothing and not any transmission, instead they murdered the cows they had drowned in various quantities of TB Culture soups, injected into their tracheas and lungs directly. They waited I think 3 months before THEY murdered the cows and then looked for either low, medium or high levels of the cultures in their lungs. Which THEY PUT THERE! Voila we found what we put there! It must be a transmission risk. NOPE, you put it there and it did nothing until they murdered the cows to look for it again. THAT IS NOT TRANSMISSION of anything in natural setting. So its BOGUS SCIENCE.
TB also is claimed to be in many people LATENTLY and ASYMPTOMATICLY, so….. if TB bacteria is dangerous…. yet most people already contain it? Well that’s a BLACK SWAN NULL HYPOTHESIS, which disproves that TB bacteria are dangerous at all. They are just LIARS to hock poisons yes.
Well it’s been used as a reason to mass sacrifice animals. I haven’t looked into it but I’d bet those giant burnt offerings occur on significant dates. They’ll be another one coming soon.
The dates of animal culls would indeed be an interesting pattern to look at yes. Not thought of that one before but intriguing idea. 17 million ferrets alone, endless chickens, cows, pigs globally, ducks gassed by Defra, list is endless since Covid and other claimed risks. Yeah that could make interesting research for someone.
if you go to a cancer ward there is abig notice outside the ward saying “if you have recently hadany vaccinations,please wait two weeks before visiting…..” -this is because the vaccines shed,so,when they get all the kids jabbed up,there of course will be more measles.Incidenrtly,doctors surgeries now only get their “bonus” when they have a 9-% vaccination rate….if they dont get this rate,they lose funding!!…..
PodCast
Listen LIVE!
The Richie Allen Radio Show is live Mon – Thurs 5-7pm and Sun 11am -12pm
Click the button to listen live. Stream opens in a new tab.
Support
Support the show!
The Richie Allen Show relies on the support of the listeners. Click the button to learn more.
Evenin’ all; whatever happened to Field McConnel…?
Chuck Burlingame II, was the so called pilot of the Hijack by Hani Hanjour, and yet, he was part of the Summer Pentagon Wargame on a scenario of a Plane into the Pentagon!
Chuck, was ex vietnam veteran and unlikely overpowered by some scrawny terrorists.
Oddly Barbara Olson, was on Flight 77 too, and called Ted Olson her husband, working in the Pentagon, from a seat back phone, in reverse charges, which was later retracted, as it was proved that that model of Boeing, had no seat back phones!
Ted, despite his wifes death JUST NOW, went and gave a press speech from the Pentagon Lawn, about her phone call describing “Terrorists on the plane wearing headbands and with bomb belts!” All very very suspicious!
There were parts of shredded United Airlines plane fuselage all over the lawn, pictured being picked up, plus landing gear, wheels and engine parts inside the pentagon. Burnt chairs and more. Oddly the serial numbers of engine parts were wrong, and the Flight Recorder NIST data flight path, does not match the claimed flight path. Despite endless highway witnesses and seized cameras, we still are in the dark of the truth of what happened.
Same with 7/7. The more you look the weirder it gets. All on purpose.
GLOBAL HAWK tech MUST have been used to override the PILOTS and precision slam into every target.
GodBlessHim,NoGoodDeedGoesUnpunished
RE: 9/11: A dental receptionist actually fell down a flight of stairs in haste and panic, to inform the sedation clinic doing maxillofacial surgery I was in, that “A PLANE has hit the Twin Towers!”. I later on a break, got to call my ex-wife, and she speaking on the phone, whilst PLANE 2 slammed live into the 2nd Tower! That is my FLASHBULB MEMORY of 9/11.
I was too busy to even look into it all unto 2005, and saw WTC7 fall for the 1st time. I called my wife downstairs to rewatch the clip and we both said…. “OMG that’s a Controlled Demolition, neatest ever seen and how the hell have we never heard of this before on 9/11” So began our wake up call for real.
I’m of a mind to believe the “no plane” theory…
How is it possible for a aluminium bodied object to penetrate a steel and concrete building ?
Minoru Yamasaki designed the Towers to take multiple, smaller, faster, higher kinetic energy plane impacts at full speed and full fuel loads.
Aluminium would have shredded to pieces at those speeds but the heavier engines and landing gear would have gone into the building and as we saw, through it! They landed in the street. Or in the inner rings of the Pentagon, despite the one section of hardened concrete that had been installed on that particular area a few years earlier. Which was a penetration test perhaps of such reinforcement work. Along with possible bombs. Pictures of plane parts at all sights are there. Less so with Flight 93’s crater, as its claimed its debris field was over a massive area, from an explosion before it crashed.
I was in LA with th Rodney King thing. The TV continually showed him beaten up then after that they showed a white lorry driver being pulled out of a truck and beaten to death. Scum of the earth the media.
Evening folks, late to the party, just back from the gun club.
I disagree that we are closer to global conflict than ever, certainly not nuclear. I think the complete opposite may be true. Because the hidden hand has almost total control over nation states, more so than any other time in history. Therefor very unlikely to happen unless wanted.
I dont believe a devastated planet is wanted, rather they want it as their own playground. I believe Orwell, who spoke of perpetual controlled conflict being necessary, in order to keep the masses in check.
My bro and wife used to do Dry January but throughout such, they were stockpiling booze and planning huge parties as soon as February hit! They would always hit the stuff harder on each return! It was predictable as drinks slippery slope! However they are now very healthy again and running marathons and such, despite undisclosed batches of covid shots, which MUST have been Saline ones, or they’d be dead.
Evening Richie, great THE PAPERS show today! 🙂 Evening one and all 🙂
Hi Pan, I laughed my socks off, at Richie’s imagined responses to some people being asked to have jabs. The funniest being the school girl telling her teacher. ” Why don’t you just f**k off.” He he he, ha ha ha ha haaaaaaaaaaaaaa.!
Evening Fox, yes Richie is very funny in his wordplay and mockery and his epic rants! Always amusing 🙂
From the other night.
Dog wagging tail.
Since one of the main senses of a dog is the nose, and at the other end it has a sent gland, this wagging of tail wafts it’s sent as a way of greeting to other dogs and people it knows.
It’s a dog handshake.
In my opinion.
Or it might of been in ‘The Papers’.
yeah the tail wagging thing, was IN “The Papers” the other day and as Ben Elton once famously did a routine of, on Saturday Night “live” back in the Eighties, he explained why all newspapers were full of shit, where they belong.
It was squirrels and where they squirrel away their nuts….. obviously not where they choose to store their food away!
So Squirrels, choose different trees for food and nests and crapping in!
Well the Logging companies come around and put an X here or there an X everywhere to a Squirrel an X X X and so they chose the trees with the X on, to shit in, as their place to.
Those trees X marked, get cut down later by loggers, if an Alien Encounter from a different kind does not happen to the whole crew and only someones Fire of the Caught you Rye, then…and only then…. when Travis had been returned did the logging company take down all the XXX marked trees and so it went!
Which meant, that the remaining trees, got chopped down, whilst bright eyed, bush tailed ones hid and those trees with X’s on, got made into newspapers!
Yeah the ones full of shit!
Nothing has changed since Ben Elton pointed that out in the 80’s when I was a child.
its obvious that cancers are on the rise nobody was diagnosed during convid and the poison jabs only added to the amount of cases, big harma dont want cures only customers
Royal Rife Colin?
The lack of diagnosis during conFLID was disproven in various papers. Serious screening did indeed continue to take place, in the EMPTY DonnorCNT HERO EATING, Tik Tok Dancing nursing wards.
Whitty tried later to blame it on lack of statins. Which was even shot down by jab hocking Lack of Evidenced Professor CUNT Malhotra as Abi Roberts would say deservedly. Especially when he hocked it to BAME and then admitted later….oh…shit…my dads dead…I never even check the jabs out! OR ANY PRIOR JABS…that he had hocked for decades!
Big harma — I like it Colin 👌
Always good to hear from Paul. Pyke’s letter to Manzini predicted the destruction of Israel and the Muslim world. Sounds like he may have been right!
Did you know that, Sebastian Fox, Corinne Stockheath, and Michael Green are all Grant Shapps ?
Hmmm not quite sure what you mean here Joe Public.
are you suggesting they are one ACTOR? or Something else?
These were all names used by our minister of war before he went into politics.
What a great man PCR is. Fascinating listening to him. Great work Richie .
Every time I hear Paul, he reminds me of Blain in the first Predator film.
You haven’t got time to grow tobacco to be a sexual tryannosaur, as you are dug in, like a gardeners assistant tit!
You haven’t got time to grow tobacco to be a sexual tryannosaur, as you are dug in, like a gardeners assistant tit!
Hi Pan, I accidentally grew a tobacco plant at one of my customers last year.
We don’t know how, but one appeared in his garden and we went with it. I was going to dry the leaves and have a go, but it got destroyed when we had the first frost.
Russia dragging its heels supporting Iran is only the latest example of why I don’t trust Putin as an opposition to the NATO cabal…
https://euripides.substack.com/archive
USA & UK want IRAN to ReAct… They want to Drag Iran into it so, Nothing will stop them. Even if they make such announcement, There could a Psy-Op a Flas-Flag to counter it
Vaccines have likely been the primary cause of illnesses for over a century
By Rhoda Wilson
https://expose-news.com/2023/02/02/vaccines-have-likely-been-the-primary-cause-of-illnesses-for-over-a-century/?cmid=3a716d9b-5c6b-4fde-bdce-c52c1615cf3f
It doesn’t matter that Penny Mordant is “only carrying out orders”; carrying out criminal orders is itself a crime, and you have to start prosecuting the front person to get any chance of exposing the conspiracy…
I sent you yesterday the WAKEFIELD Court case evidence documentary Richie! He was vindicated but via co-authors as not able to appeal such himself!
https://childrenshealthdefense.eu/chd-europe-tv-english/
He also never stated MMR = Autism, merely “precautionary principles, as something seemed to be going as possible causal relationship of MMR jabs, and all the issues noted!” – paraphrase of course.
Wakefield did NOTHING WRONG EVER and came back with a Vengeance to prove far more than he ever knew he had ever stumbled upon by accident!
Dr Richard Halvorsen, was a prior TV Doctor, as was Dr Vernon Coleman.
Coleman, stood strong over a far simpler issue, of medical privacy as “Patient Doctor Relationship” over SICK NOTES!
NOW… we have PCR TESTS and LFT and Rapid Antigen and PINGDEMICS of Bluetooth enabled DUMBFUCKS on “Smartphones” all taking FAKE PCR and other tests, and then allowing, or believing a PING means a +VE COVID TEST and that they have to stay home for 14 days…. playing X-BOX and selling arse on ONLY FANS!
Now…. Halvorsen called out the Aluminium in jabs! He lost his TV Doctor Career.
He again….stumbled onto a TRUTH!
He got tired of ANTI-VAXXER MUMS in his medical practice and decided to DEBUNK ANTI-VAXXERS and he FAILED….
Instead…. he said…WTAF? And spent 7 years to write his book pre HPV “the vaccine too soon chapter!” …predicting the HARMS that HPV jabs would cause, over the 11th lowest cancer in women, that also had NO PROOF that HPV exists, or causes Cervical Cancer. WHICH IT DOES NOT!
Halvorsen over MMR, decided like Wakefield to go back to SINGLE JABS….AFTER…IMMUNITY BLOOD TESTING?
Recall that DAISY PRICK TEST at school? Seeing if you had a reaction? If no reaction….they gave you the SHOTS of BCG for TB and a gamut of Jabs etc.
Because they sold the idea of return to single vaccines and not M M R, all of which are POINTLESS…as no such diseases even EXIST….. by even return to single shot selling to cautious parents…. they had their careers DESTROYED!!!
Defective is not the best word to describe kids wih autism
They end up UNIQUE and with view a different perspective of life. Some of them sadly, so terribly brain damaged or in other ways that they cannot function at all and neither can their parents. Others are GIFTED in new ways. Some excel.
Please see TEMPLE GRANDIN the movie with Clare Danes and the real lady!
Yes. Thanks for the tip.
Evenin’ all, I tried googling the Andrew Wakefield case and of course all the results are it pieces; its impossible to find anything from Clifford or Wakefield refuting this stuff…
https://childrenshealthdefense.eu/chd-europe-tv-english/
Brexit’s currently costing me approximately $170 per month.
What an eloquent lady on Sky News.
The Yemeni parliament in Saana has proscribed both US and UK as terrorist states and enterprises.
Theresa May…. ahh yes I recall her!
‘The worst part about being lied to is knowing you weren’t worth the truth.’ Jean-Paul Sartre.
Theresa : A Cautionary Tale
(with apologies to Hilaire Belloc)
by PKM
Theresa told such Shocking Lies
It made one Gawp in Stunned Surprise,
A Troubling Trait and somewhat Odd,
Her Father being a man of God,
A Firm Believer in Veracity
Whose Only Child espoused Mendacity.
Having made Money in the City,
Theresa soon was Sitting Pretty
And set sail on her Next Career
To achieve an Aim she’d long held Dear,
For telling Lies she knew would be
An Asset in a new MP.
She Networked daily hour by hour
Until she Rose to Giddy Power
In charge of UK Home Affairs.
(She’d made it up the slippery stairs!)
Now she would Make them all Obey.
They’d find Hers was the Only Way.
With HMRC she made her mark
And singled out one Brodie Clarke.
That Man must Learn to Follow Orders
And Gain Control of UK borders.
Illegal Migrants coming over
And flooding through the port of Dover
Was Not Theresa’s Plan at all.
She’d Pledged to Make the Numbers Fall,
But chopped Five Thousand Staff instead
And then, alas, poor Brodie’s Head.
He lost his Job, his Reputation,
But thanks to Damage Limitation—
A secret settlement some guess—
Theresa Shed Blame for the Mess
And moved against our Boys in Blue
To tell them Bluntly they Must Do
Far More for Less! Commands they heard
And met with Silence. Not a Word!
She sent home Students by the Score
Although it was against the Law.
She claimed they’d Failed their English Test,
Which wasn’t True, but she Knew Best.
Hah! away with Human Rights Acts!
Fiction’s far more Fun than Dull Facts!
‘We all know tales of HRA,
Why Migrants can’t be sent away.
Because the poor Man has a Cat!
It’s true! What do you think of that?’
‘Rubbish! Just a made-up Story!’
Cried Old Ken Clarke, the Justice Tory.
Her Promise to make Numbers Fall
Remained an Order far too Tall
For still they came, just as before,
From Far and Near and every Shore.
The Numbers Never did come Down
Of white and yellow, black and brown.
Now six years on the country’s Lock-ups,
Because of Saint Theresa’s Cock-ups,
Are Over-crowded, full of Drugs,
And run by Rioters and Thugs
In Crumbling Buildings, short of staff,
But for Theresa it’s a Laugh.
She’s moved on Upwards on a roll.
She’s PM now in full Control.
‘What joy, what bliss!’ the Tories Bray,
‘Now Nanny’s running the UK.
We’ll send those Bloody Foreigners packing.
We’ll kick the Poor and stop them Slacking.
Brexit’s the next stage in our story.
Back with the clocks to Days of Glory
When Britain was Great and Life was Hell,
And Workers knew their place as well.
An island race we’re Proud to be,
Alone we’ll stand, Proud to be Free.’
Free to be weaker, poorer, spend less; Free to be hungry, homeless, friendless;
Free to be ill unless we Pay; No NHS, just USA?
‘Pah! hoist the Flag; we Rule the Waves.
We Brits, we Never shall be Slaves!’
Theresa’s pledged—her Will be Done!—
The Country’ll work for Everyone
When she has used her female charms
Selling murdering Despots Arms.
Pride comes before a Fall they say
And soon will come the Reckoning Day
For Proud Theresa. She will Learn
That boats can Capsize, Sink or Burn.
Does anyone know how there are any of these Yemeni Houthi’s left? I’m pretty sure that Saudi Arabia and the UK have been blasting them with giant weapons for 10 years now. Whatever they’re doing they must be pretty good at it.
Richie,forthoseofuswhowanttoavoidEMRradiationandsurveillanceitssadthattheforumisbeingsupplantedbytheapp.
SPOTTEDDICKSJACKSSMARTAPPSFLAPPEDASMACKSFROMATOWERSGEOLOCATESSMACKEDASSEDDIPPYSHITSISNEVRTOOSHITZYBLIZTEDTORECOGNIZETHESYSTEMSWONDERWHIPSOFCHIPSTOBECHAINSSOONUPONYOURREPLACEDAPPLEDWATCHEDWRISTSANDBACKTOFULLSLAVECOLLARSASTHEIRSLAVESAMIDSTTHESOCALLEDELITESANDITSALLASCAMJUSTASBEFOREYET5GWILLGIVETHENETFLIXFORPORNHUBFASTERANYDAYSOHEYHOHAILHOESANDOFTHEFREEDOMTOTHEBLUESMURFSGOANDGARGLEWELLSCATSWALLOWSNOTSPATANDITSWHATALLOURPOLITICIANSANDBANKERSTHINKOFTHATASVIEWEDASSPEWEDDOWNTHROATEDTHROATSWEAREASIFWEWEREBELUGACAVIARANDANOYSTERFROMAWALRUSFROOACARPENTERTHEYREFSUETOPAYTOHOUSEUSORALLOWTHENAILSONTHEIROWNCROSSESBACKSTOCARRYASTHEYALLCARRYONHAPPYASLARRYANDNOWALLOWANCEFORTHEREALASTHEYASTHIEVESANDFAKESAVIOURSINTHEMIDDLESHALLBERIDDLEDBESTSTILLANDSENTINTOTHATLONGKNOWNOFEXILEDEMONDFILLED
If the lesbians place an ad for a donner ,blokes will be queuing around the block.
https://jamesroguski.substack.com/
The WHO can talk about this all they like. I will under no circumstances go along with their rules. I was not in the room when they agreed what ever they agree. You want to know who can stop this nonsense, just look in the mirror!!
They are talking about things worse than covid, yet covid managed not to cause annual excess deaths . Though it was supposedly much worse than regular flue. After the scam of the last 4 years worked so well, there is absolutely no need to knock out something genuine. Surely the only weapons needed are the JABS, which have been proven to cause harm and kill.
Spot on. Tedbros said Covid was the prior Disease X and came along. NO NOTHING DID. So now he says “X is name for unknowns we expect soon, but X IS KNOWN” Which means he is suggesting they already know what new Disease X.
As you say Covid did nothing. It was a fear campaign and nothing real. No excess deaths anywhere, all other death iatrogenic and medical murders and malpractices. No pandemic. Now we have a REAL JabOdemic and death through the roof in all ways possible and ZIP ZILCH spoken of such. Its all a scam.
Thanks well said. Jabodemic yes. They will simply pass off various symptoms as a new disease, as they have before. Only this time it will be due to the Jab injuries and deaths still to come.
https://www.jayne-donegan.co.uk/
Thats better… =)
I’m confused.
I thought we were meant to “eat ze bugs”, now I’m being told we have to find them first?
Different bugs?
I’ll get me coat…….
Ahahahha so well put mate 🙂
It wasn’t my best work, but if it made one person smile, it was worth doing.
Podcasting with Chris again tonight Pan, if you’re about later, come and say hello.
I found it funny yes mate. I will pop along for sure, whilst amidst other shows 🙂
Pathogens with pandemic potential is all nonsense sorry. They are fearmongering and want to share in-sillico modelled, made up sequences, from genebanks, which are all unproven in reality and merely constructs, of a soup of cell cultures. So its a lie basically.
This is nonsense as you say. They are talking about things worse than covid, yet covid managed not to cause any excess deaths. Yet we are told how much worse it was than regular flue. After the scam of the last 4 years worked so well, there is absolutely no need to knock out something genuine. Surely the weapons’ are the JABS, which have been proven to cause harm and kill.
‘They’ are the virus.
Oh yes! We need a real vaccine, or at least lots of needles in voodoo dolls of them for now, as we have not exhausted that option of maybe working for now. Afterall they have Shamans blowing spirits into their heads at the WEF. So W.H.O knows, perhaps such will work before we have to shove every vile vial of their toxic crap into themselves for real 😉
Hi Baird, yes indeed.
Computer modelling is the king bullshit of all bulls in this.
I am not convinced that ‘they’ can’t engineer pathogens though. It may be that it’s not worked to engineer so-called viruses that transmit, however can they get something into the masses? – I’d say yes – and if I’m combination with environmental factors that they do control I do think they can engineer a pandemic.
I believe this agreement is the next step in going live with open totalitarian world goverment. The opening salvo which happened in 2020, where around the globe the world was put under medical tyranny. The WHO being a department of the world goverment, though they are administrating orders of the unseen. It seems the plan is to use ‘medical science’, as the driving force behind the whole agenda. Even climate change is being tied in with our health.
Good point, well made Fox.
Thanks Chris, what’s new with you.?
All good mate, beautiful day today in Narfolk.
I’ve got a big number 12 on my back this evening, I’ve been called off the bench by Mr Von Essex for tonight’s show, so Hopefully see you there.
When do we get to see you again? Chris said you’re doing a pre-record sometime soon??
I was originally booked for tonight, but put it off till next Monday. ”Law of attraction special”. I’ve not been well so i still have a lot of prep to do. The pre-record has been done. We did it in one take the other week. I’m just waiting for Chris to edit it, and add the video clips I’ve sent him. I will do my best tonight, take care. Fox
The WHO can talk about this all they like. I will under no circumstances go along with their rules. I was not in the room when they agreed what ever they agree. You want to know who can stop this nonsense, just look in the mirror!
Spot on Diane, that gets a “like” from me.
I can’t get to Jayne’s website.
http://www.jayne-dunigan.co.uk/ ?
Seems dead yes
Hmm…
No results on Google or even twitter; Do we have the spelling right…?
Could it be being blocked?
I have been listening since 2014 and with my hand on my heart Jayne is the best guest ever! From William with a W 🙂
” We are reaching a turning point in our history, the proof is everywhere. The world is becoming a more dangerous place.” Grant Shapps MP
Recent online advert. Where throughout Shapps gleefully talks of things such as viruses and preparing for war with Russia. Fear propaganda at its finest.
https://twitter.com/grantshapps/status/1746914238935818583
Hi_Richie_they-name-storms-after-both-boy-and-gril-names-every-secon-one
Hi Richie
I firmly believe that the childhood jabs caused my daughter’s childhood Leukaemia.
So many kids developing childhood cancers age 3-5.
When I was young in the 60s kids were much healthier than they are now.
Autism and cancer in kids were extremely rare pre the mass jab roll outs.
Given Polio is unproven as a virus, instead DDT more likely, we know that Gates polio jabs spread fecal oral to other kids in India and elsewhere and cause Acute Flaccid Paralysis (same as “Polio” symptoms). So what is really in the Polio shots? Is it DDT which then poisons others too?
Yup, nobody heard of flacid myelitis before polio jabs and now, when polio is supposed to be gone, we have this instead…
Bingo, Doctors were told that Polio shots had eradicated Polio and they changed the way the same symptoms were labelled, to make it look so, as they slowly withdrew DDT and Lead Arsinates.
Same things with SIDS in babies from vaccines. They relabelled such as Suffocation, or Shaken baby syndrome, or anything but Sudden Infant Death Syndrome and it carried on regardless, whilst they ramped up DTP and Dtap shots and carried on murdering babies and blaming mums for COT DEATH and how they put the baby down at night and blah blah blah. Anything to cover the jab to SIDS link.
Now we have SADS, priorly rare but classified I think in 2012, but now any excuse to excuse the covid shots from SADS. Shaking your duvet too hard, shovelling snow, too much or too little heating, too much exercise or sex, climate change… anything but say “YUP the JABS ARE KILLER!”.
22 years ago I delivered my first baby. In hospital they told me my blood showed I was not immune to German measles. I was instructed to get jabbed for it before leaving the hospital. I took the jab because I trusted them. I was young and dumb and regret it, but not as much as I regret vaccinating my children all their lives until 2017 when I started digging.
Greetings, theres going to trouble if they really phase out smoking and replace it with “heated tobacco”; I tried it myself in the hope I could switch my mum over to it as she couldn’t stand vapes, but it tastes terrible, a bit like lighting a ciggy at the filter end…
This new time is still catching me out! The penny will drop with me soon!
How can you have a LIVE VIRUS, when they have always said Viruses are DEAD and require living host cells to replicate within, using the host cells machinery, and their Virus code to copy? So attenuation supposedly weakens, something DEAD? Do the jabs contain LIVE HUMAN CELLS that the viruses are busy replicating within? If so, then the Ingredients lists will be WRONG, as they claim a specific number of viral particles in each shots vial? LOGICALLY it’s therefore all BS.
They cant even show you a viral particle, yet they can weld nanobot materials together 1000x smaller than claimed viral particles, and SHOW YOU pictures of such! Makes no sense.
Yeah it’s rubbish isn’t it. They just add something utterly toxic like formaldehyde to the contents to ‘attenuate’. Or they’ll supposedly delete certain proteins from the ‘virus’. It’s easier with bacterial vaccines to ‘weaken’ them, but in general I think it’s best to accept that almost all vaccines are totally unnecessary and designed to make us all sick.
Yeah it all seems made up. How can you delete a protein, on the cell surface of something in the millions, that you cannot even prove you can see at all? Makes no sense.
bacterial vaccines, like HIB or TB etc I accept are genuine bacteria we can see and yes we can weaken them and not kill them prior to injection. However foundational science on TB bacteria in Cows, proved nothing and not any transmission, instead they murdered the cows they had drowned in various quantities of TB Culture soups, injected into their tracheas and lungs directly. They waited I think 3 months before THEY murdered the cows and then looked for either low, medium or high levels of the cultures in their lungs. Which THEY PUT THERE! Voila we found what we put there! It must be a transmission risk. NOPE, you put it there and it did nothing until they murdered the cows to look for it again. THAT IS NOT TRANSMISSION of anything in natural setting. So its BOGUS SCIENCE.
TB also is claimed to be in many people LATENTLY and ASYMPTOMATICLY, so….. if TB bacteria is dangerous…. yet most people already contain it? Well that’s a BLACK SWAN NULL HYPOTHESIS, which disproves that TB bacteria are dangerous at all. They are just LIARS to hock poisons yes.
Well it’s been used as a reason to mass sacrifice animals. I haven’t looked into it but I’d bet those giant burnt offerings occur on significant dates. They’ll be another one coming soon.
The dates of animal culls would indeed be an interesting pattern to look at yes. Not thought of that one before but intriguing idea. 17 million ferrets alone, endless chickens, cows, pigs globally, ducks gassed by Defra, list is endless since Covid and other claimed risks. Yeah that could make interesting research for someone.
if you go to a cancer ward there is abig notice outside the ward saying “if you have recently hadany vaccinations,please wait two weeks before visiting…..” -this is because the vaccines shed,so,when they get all the kids jabbed up,there of course will be more measles.Incidenrtly,doctors surgeries now only get their “bonus” when they have a 9-% vaccination rate….if they dont get this rate,they lose funding!!…..